<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1075 1075-30314 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, L90M L10F, Q58E, G73GS, L89V V11L, I13V, K20T, E35D, M36I, N37D, D60E, Q61E, L63P, A71I, V77VI, I93L  
>1075-30314| codons 4-99
TLWQRPFLTVKIGGQLTEALLDTGADDTILEDIDLPGRWKPKMVGGIGGFMKVREYEEIP
IEICGHKIISTVLIGPTPVNIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MV, L210W, T215Y K219R     K43Q, E44ED, K122E, I142V, D177E, I195T, G196E, T200A, H208Y, R211K, K223E, L228R, V245T N57H, E203DN
>1075-30314| codons 38-247
CTELEQDGKISKIGPENPYHTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLETEQHRAKINELRQYLWKWGFYTP
DRKHQEEPPFRWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006