<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1074 1074-30313 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, T215F D67G, K219Q Y181C, Y188L, G190A   A98S, K122E, I135T, I142IV, T200E, E203D, F214L, D218E, L228H  
>1074-30313| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLLVASDLEIGQHREKIDELRQHLLRWGLFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73GS L10I, T12K, I13V, I15V, K20I, E35N, M36I, N37E, R57K, D60E, I62V, L63P, A71T, I72V, P79A  
>1074-30313| codons 4-99
TLWQRPIVKVKVGGQLIEALLDTGADDTVLENIELPGRWKPKMIGGIGGFIKVKQYEQVP
IEICGHKTVSTVLVGATPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006