<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2115 2115-30625 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, L210W, T215F A62V G190A A98G, V179D E44D, S68SG, K101Q, V111I, D121C, K122E, D177E, I178L, T200A, Q207E, H208HY, P243T  
>2115-30625| codons 38-247
CTELEKDGKISKIGPENPYNTPVFVIKKKDGTKWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLQKKKSVTVLDIGDAYFSVPLCEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPELDIYQYMDDLYVASDLEIGQHRAKIEELREYLWRWGFFTP
DKKHQKEPPFLWMGYELHPDKWTVQTIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73C I13V, G16E, K20I, I62V, L63Q, I64V, T74S, T91S  
>2115-30625| codons 4-99
TLWQRPFVTVKIEGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDQVQ
VEICGHKAICSVLVGPTPVNVIGRNLMSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006