<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1828 1828-30529 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219H Y181I A98G, V108I S48T, E53D, K173T, Q174K, G196E, I202IV, E203V, D218E, L228H K46M, L210I
>1828-30529| codons 38-247
CTEMEKEGMITKIGPDNPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTILDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTKNPDIVIIQYMDDLYVGSDLEIEQHRTKVVELRQHLIRWGFTTP
EHKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54L, I84V, L90M L10FI, G73T I13L, E34Q, I62V, L63P, I64V, I66V, P79D, I93L  
>1828-30529| codons 4-99
TLWQRPIVTLKIGGQLKEALLDTGADDTVLQEMNLPGRWKPKIVGGIGGFLKVRQYDQVP
VEVCGHKAITTVLVGDTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006