<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1660 1660-30528 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82C, I84V, L90M L10F, V11I, F53L, G73A, L89V I13V, I15V, G16A, K20I, K55R, R57K, L63P, T74S, P79A  
>1660-30528| codons 4-99
TLWQRPFITVKVAGQLIEALLDTGADDTVLEEMNLPGRWKPKIVGGIGGLVRVKQYDQIP
IEICGHKAIASVLVGATPCNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, T215F K219Q Y181C, G190A   V60I, K102N, V118I, K122E, I135T, S162D, V179I, T200IR, Q207E, R211RK, F214L, D218E, L228H, V245E  
>1660-30528| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKNKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDIIICQYVDDLYVASDLEIGQHRRKIEELREHLLKWGLFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006