<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1827 1827-30528 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q K103S, G190A K238T K64H, K122E, Q174QR, V179I, G196K, I202IV, Q207E, R211RK, L228Q T69NY
>1827-30528| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIHKKNSYRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIIIYQYVDDLYVASDLEIKQHRTKVEELREHLLKWGFFTP
DQKHQKEPPFQWMGYELHPDTWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F L10I, L19I, K20R, E35D, M36I, N37D, R41RK, K55KR, I62V, L63P, K70KE, A71V, I72L, I85V, I93L  
>1827-30528| codons 4-99
TLWQRPIVTIKIGGQIREALLDTGADDTVFEDIDLPGKWKPKLIGGIGGFVRVRQYDQVP
IEICGHEVLGTVLVGPTPANIVGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006