<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1655 1655-30528 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184MV, L210W, T215Y   K103KN A98G E44D, V60I, K102KR, V118I, K122E, I135T, S162C, G196E, R211K, V245VE  
>1655-30528| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKRNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82F, L90M G48E, F53FL L10I, G17E, K20T, M36MI, I62V, L63P, A71V, V77I, I85V, I93L  
>1655-30528| codons 4-99
TLWQRPIVTIKIGEQLTEALLDTGADDTVLEEINLPGRWKPKLIEGIGGLVKVRQYDQVP
IEICGHKVIGTVLIGPTPFNIVGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006