<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1656 1656-30527 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54L, I84V, L90M L10F, G73T K20R, M36I, K55R, R57K, I62V, L63P, A71V, I72V, I85V, I93L  
>1656-30527| codons 4-99
TLWQRPFVTIKIGGQLREALLDTGADDTVLEEINLPGRWKPKIVGGIGGFLRVKQYDQVP
IEICGHKVVTTVLVGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, M184V, L210W, T215Y K219R   V108I, K238T K43N, V118I, K122E, S163C, R211RK, H221Y  
>1656-30527| codons 38-247
CTELENEGKISKIGPENPYNTPVFAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSCMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DRKYQKEPPFLWMGYELHPDTWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006