<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1657 1657-30527 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54M, V82AT, I84V, L90M L33F, K43T L10V, I13V, D60DN, L63P, I66F, A71V  
>1657-30527| codons 4-99
TLWQRPVVTVKIGGQLKEALLDTGADDTIFEEMNLPGRWTPKIIGGIGGFMKVRQYNQIP
IEFCGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K103N   V60VI, D121Y, K122E, I135T, I178M, T200A K238G
>1657-30527| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDGWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006