<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1064 1064-30522 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MIL, I54ILM, I84V, L90M V11VI, L33F, G73C L10I, I13V, M36ML, R41K, K55KR, I62IV, L63P, A71T, I72R, V77I, I93L  
>1064-30522| codons 4-99
TLWQRPIITVKIGGQLKEALLDTGADDTVFEELNLPGKWKPKLIGGIGGFMRVRQYDQVP
IEICGHKTRCTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q     V60I, T69N, K122E, D123N, I135T, S162SDGN, D177E, I178IM, V179VI, G196E, T200A, Q207E, H208HY, D218E, L228H  
>1064-30522| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPEMIIYQYVDDLYVGSDLEIEQHRAKIEELREYLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006