<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1061 1061-30325 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I47V, I54M, I84V, L90M L33F I13V, E34EQ, R41K, L63T, I64L, I66L, A71V, I72T, T74A, V77I, I93L  
>1061-30325| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTIFQEMNLPGKWKPKLVGGIGGFMKVRQYDQIT
LELCGHKVTGAVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, V75VI, F77FL, F116Y K103N   D123E, I135T, S162N, K173KE, D177E, R211S, F214L  
>1061-30325| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYYSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQNSMTKILEPFREQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLSWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006