<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1869 1869-30722 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84IV L24I, L33F, K43T, F53FL, G73GISV L10I, I13IV, K20R, E35D, M36I, N37E, R57RK, I62IV, L63P, A71AV, T91S  
>1869-30722| codons 4-99
TLWQRPIVTVKIGGQLREALIDTGADDTVFEDIELPGRWTPKIIGGIGGLVKVKQYDQVP
IEICGHKVIVTVLVGPTPANVIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SA, M184V, T215Y A62V V106VA F227FL W88C, K122E, I142V, T200A, V245E  
>1869-30722| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKKKDSSKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTP
DKKHQKEPPLLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006