<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1866 1866-30506 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M L10F, L33F, Q58E, G73S E35D, M36I, N37H, K55KR, I62V, L63P, A71V  
>1866-30506| codons 5-99
LWQRPFVTIKIGGQLKEALLDTGADDTVFEDIHLPGRWKPKLIGGIGGFVRVREYDQVPI
EICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, M184V, L210W, T215Y K219N K101P, G190GA   E40F, K43E, S68G, K102R, L109I, K122E, E138Q, V179I, T200A, L228HQ  
>1866-30506| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKDGTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLPRKKSVTVIDVGDAYFSVPLDEDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVASDLEIGQHRAKIEELRQHLWRWGFYTP
DNKHQKEPPFQWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006