<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1060 1060-30429 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M L33F, Q58E, G73S I13V, I15V, K20T, E35D, M36I, N37ND, I62V, L63P, K70E, A71V, V77VI, I93L  
>1060-30429| codons 4-99
TLWQRPLVTVKVGGQLTEALLDTGADDTVFEDIDLPGRWKPKLIGGIGGFIKVREYDQVP
IEICGHEVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N     K43E, E44A, R83K, K102Q, V118I, K122E, D177E, I178L, I202V, Q207E  
>1060-30429| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPELVIYQYVDDLYVGSDLEIGQHRTKVEELREHLWRWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006