<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1057 1057-30325 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V, L90M L10F, F53L T12K, I15V, K20R, E21D, M36I, N37D, R41K, K55R, D60E, I62V, L63P, A71V, Q92K  
>1057-30325| codons 4-99
TLWQRPFVKIKVGGQLRDALLDTGADDTVLEEIDLPGKWKPKMIGGIGGLVRVRQYEQVP
IEICGHKVIGTVLVGPTPANVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K103N V108I, P225H K101Q, K122E, D123E, I135T, D177E, I178M, H208HY  
>1057-30325| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKNKSVTILDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRTKIEELRQYLLRWGFFTP
DQKHQKEHPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006