<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1056 1056-30318 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q Y181C   K49R, V60I, K101KR, V118I, K122E, I135T, S162D, S163SC, E169EA, V179I, I202V, R211K, F214L, L228R  
>1056-30318| codons 38-247
CTEMEKEGKISRIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLRKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQDCMTKILAPFRKQNPDIIICQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGLFTP
DQKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, I84V L24I, L33F L10I, K20R, E35D, M36I, N37DE, L63P, A71V, I93L  
>1056-30318| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVFEDIELPGRWKPKLIGGIGGFLKVRQYDQIP
IEICGHKVIGTVLVGPTPVNVIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006