<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2037 2037-30702 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, L90M G73S, L89V L10IV, I15V, L19I, K20R, M36I, G51A, K55R, L63P, H69Q, A71IV, I93M  
>2037-30702| codons 4-99
TLWQRPVVTIKVGGQIREALLDTGADDTILEEINLPGRWKPKIIGGIAGFVRVRQYDQIP
IEICGQKVISTVLVGPTPANIIGRNVMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215Y   K103N, Y188L A98G V60VI, K64KR, I94IL, K122E, I135IATV, K173Q, G196E, T200A, E203V, K223KEQ, L228LR, V241VI  
>2037-30702| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGLPHP
GGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRQQNPDIVIYQYVDDLLVGSDLEIEQHRAKIVELRQHLWRWGFYTP
DKKHQQEPPFRWMGYELHPDKWTIQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006