<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2033 2033-30618 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F, G73S I13M, I15V, K20V, M36I, I62V, L63P, I66V, A71V, N83S  
>2033-30618| codons 4-99
TLWQRPFVTMKVGGQLVEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYDQVP
IEVCGHKVISTVLVGPTPVSVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   K101E, Y181C, G190A K238N E40F, K43E, V118I, K122E, D123DE, I135V, K166Q, D177E, R211K D237T
>2033-30618| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTQILEPFRKQNPEIVICQYVDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPTNWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006