<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2164 2164-30724 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I50V, V82A L10F, L33F T12N, M36L, N37D, L63P, A71V, Q92K  
>2164-30724| codons 4-99
TLWQRPFVNIKIGGQLKEALLDTGADDTIFEELDLPGRWKPKIVGGVGGFIKVRQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219R     E44D, V118I, K122E, I135V, S162C, D177E, I195IT, G196E, E204G, R211K  
>2164-30724| codons 38-246
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLETEQHRTKIEGLRQHLWKWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006