<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2372 2372-30730 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, Q151M, M184V A62V, V75I, F77L, F116Y G190S   T58N, S68K, D123E, I142T, S162ST, S163SC, E169D, I202IV, R211K, V245M  
>2372-30730| codons 38-247
CTELEKEGKISKIGPENPYNNPVFVIKRKDKTKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYYSVPLDKEFRKYTAFTIPSINNETPGTRYQYNVLPMGWKGSP
AIFQTCMTKILDPFRKQNPDIVIYQYVDDLYVSSDLEIGQHRTKVEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54L, I84V, L90M L10F, L33F, Q58E, G73S, L89V I13V, I15V, K20R, E34Q, E35D, M36I, N37D, I62V, L63P, I66F, I72L, V77VI  
>2372-30730| codons 4-99
TLWQRPFVTVKVGGQLREALLDTGADDTIFQDIDLPGRWKPKMVGGIGGFLKVREYDQVP
IEFCGHKALSTVLIGPTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006