<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2279 2279-30819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103N, Y181YC   K43E, K64KR, V118I, K122KE, D123E, I135T, V179I, H208Y, R211K, K223T, L228R  
>2279-30819| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIRKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTP
DKKHQTEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V L33F, L89V L10I, G16A, K20R, E35D, M36I, K55KR, R57K, L63P, H69Q, A71V, T74S, Q92K, I93L N88E
>2279-30819| codons 4-99
TLWQRPIVTIKIAGQLREALLDTGADDTVFEDINLPGRWKPKIIGGIGGFVRVKQYDQIP
IEICGQKVIGSVLVGPTPVNVIGREVLTKLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006