<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2280 2280-30819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F V75T, K219E Y181C V108VI K64R, D123E, D177E, I178L, K223Q, L228H K166A
>2280-30819| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIRKKNSTRWRKITDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTAILEPFRKQNPELVICQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTP
DEKHQQEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A L24I L10I, I15V, L63LP, I64IV, I72IV  
>2280-30819| codons 4-99
TLWQRPIVTIKVGGQLKEALIDTGADDTVLEEMNLPGRWKPKLIVGIGGFVKVRQYDQIP
VEICGHKAVGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006