<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1329 1329-30715 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F V75L, K219E K103N, Y181C, G190A V179F K122KE, T200A, H208Y, R211K, L228R, V245M D192DY
>1329-30715| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLLDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIFICQYMDDLYVASYLEIGQHRAKIEELRQYLLKWGFFTP
DEKHQKEPPFRWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M F53L L10I, T12TP, K20R, E35D, M36I, N37ND, R41K, K43KI, K55KR, I62V, I64IV, K70KE, A71IV, P79PS, V82I, T91S, Q92QK, I93L, C95F  
>1329-30715| codons 4-99
TLWQRPIVPIKIGGQLREALLDTGADDTVLEDIDLPGKWIPKIIGGIGGLIRVRQYDQVL
VEICGHEVIGTVLVGSTPINVIGRNLMSKLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006