<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1324 1324-30501 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54IL, V82A, L90M L33F, F53FL L10V, I13V, G16GA, K20T, L63P, A71V  
>1324-30501| codons 4-99
TLWQRPVVTVKIAGQLTEALLDTGADDTIFEEMNLPGRWKPKIVGGIGGLLKVRQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, T215F K219E K103N, Y181C   K66KR, V90I, K101KQ, K122E, I135T, S162Y, G196E, L228R, D237E  
>1324-30501| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKRNSTRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLQKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTP
DEKHQKEPPFRWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006