<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1532 1532-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69T_T, K70R D67G, K219Q K103N V108I K64N, V90I, I135T, S162Y, D177E, Q207E, L228H, V245E  
>1532-30821| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAINKKGSTRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTILDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTP
DQKHQKEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L10FV, L33F, K43KT, T74TP I13V, K14R, I15IV, K20KT, M36L, N37NS, R41K, K55R, I62V, I64V, H69HY Q61QP
>1532-30821| codons 4-99
TLWQRPVVTVRVGGQLTEALLDTGADDTVFEELSLPGKWTPKLIGGIGGFVRVRQYDPVL
VEICGYKAIGPVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006