<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2271 2271-30822 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 69
2 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50IV, I54T, V82A, I84IV K43T, G73GA, L89V L10I, I13V, L19P, K20IM, E35G, M36I, I62V, L63P, C67CY, A71V  
>2271-30822| codons 4-99
TLWQRPIVTVKIGGQPMEALLDTGADDTVLEGINLPGRWTPKMIVGVGGFTKVRQYDQVP
IEIYGHKVIATVLVGPTPANVIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, Q151M, M184V A62V, K70T, V75I, F77L, F116Y K103N P225PH S68K, V111VI, I135L, E138G, S162H, I167IV, I178IM, G196E, T200A, R211RAGT  
>2271-30822| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKRKDKTTWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDIGDAFYSVPLDKDFRKYTAFTIPSLNNGTPGIRYQYNVLPMGWKGSP
AIFQHSMTKVLEPFRKQNPDMVIYQYVDDLYVGSDLEIEQHRAKIEELRQHLLTWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006