<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2268 2268-30808 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, L74V, L210W, T215Y A62V Y181C, G190A A98G, V179D, K238T K101Q, K122E, V189I, D192N, R211K F61FS, L187LS
>2268-30808| codons 38-247
CTEMEKEGKISKIGPENPYNTPVSVIKKKDSSKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLQKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIDICQYMDDSYIASNLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDTWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, L76V, I84V   L10IV, E35D, N37E, I62V, L63P, I64V, A71V, I72IT, V77T, V82VI, I93L  
>2268-30808| codons 4-99
TLWQRPVVTIKIGGQLKEALLDTGADDTVLEDMELPGRWKPKIIGGIGGFLKVRQYDQVP
VEICGHKVTGTVVTGPTPINVIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006