<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2151 2151-30623 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54A, V82A L10F, K43KT I13V, Q18H, K20M, M36I, N37D, R41K, I62V, L63P, I64V, T74S, L89I  
>2151-30623| codons 4-99
TLWQRPFVTVKIGGHLMEALLDTGADDTVLEEIDLPGKWTPKLIGGIGGFAKVRQYDQVP
VEICGHKAIGSVLVGPTPANIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y V75L, F77L, K219E K101E, Y181C, G190A F227FL K122E, I135T, I167IV, V179I, D218E, L228H  
>2151-30623| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLLDLRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKVLEPFRKQNPDIIICQYVDDLYVASDLEIGQHRTKIEELRQHLWRWGFYTP
EEKHQKEPPLHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006