<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1978 1978-30617 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, L76V, V82VALP, L90M L33LF, Q58E, L89LMV L10I, I13IV, I15V, K20R, E35D, M36I, N37E, K55R, R57K, I62V, L63P, A71V, I93L  
>1978-30617| codons 4-99
TLWQRPIVTVKVGGQLREALLDTGADDTVFEDIELPGRWKPKIIGGIGGFLRVKEYDQVP
IEICGHKVIGTVVVGPTPPNIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75M, Q151M, M184V, T215Y A62V, F77L, F116Y K103N V108I S68G, V90I, K102KR, I135L, S162D, T200A, E203D, Q207A, R211K, H221Y  
>1978-30617| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDGTKWRKLMDLRELNKRTQDFWEIQLGIPHP
AGLKRNKSVTILDVGDAYYSVPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPMGWKGSP
AIFQDSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIDELRAHLLKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006