<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1783 1783-30515 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_VA, M184V, L210W A62V, T215C Y188L   K43Q, I94L, V106I, V118I, K122E, D123DN, Q174R, I202IV, R211K, F214L  
>1783-30515| codons 38-247
CTELEQEGKISKIGPENPYNTPVFVIKKKDSAKWRKLVDFRELNKRTQDFWEVQLGLPHP
AGLKKKKSITVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIVIYQYVDDLLVGSDLEIGQHRTKVEELRQHLWKWGLCTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V, L90M L10F, V11I, Q58E, G73S, L89V I15V, K20V, E35D, M36I, N37E, R57RK, I62V, L63P, K70R, A71V, I72L, I85V  
>1783-30515| codons 4-99
TLWQRPFITIKVGGQLVEALLDTGADDTVLEDIELPGRWKPKIIGGIGGFVKVKEYDQVP
IEICGHRVLSTVVVGPTPVNVVGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006