<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1051 1051-30306 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74I, M184V, L210LW, T215F D67S, K219E K103N, Y181C A98AG, V108I V60I, T69N, L109I, I135T, G196E, D218E, L228H  
>1051-30306| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKSSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTIIDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFFTP
EEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A, L90M L10F, V11VI, L33LF, K43T I15V, G16A, K20KM, E34EQ, D60E, I62V, L63P, K70T, A71V, I72T, Q92K  
>1051-30306| codons 4-99
TLWQRPFITIKVAGQLMEALLDTGADDTVFQEMNLPGRWTPKIIGGVGGFVKVRQYEQVP
IEICGHTVTGTVLVGPTPANIIGRNLMTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006