<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1049 1049-30304 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47V, G48M, I54M, V82A, I84V, L90M L33F, F53L, L89V L10I, I13V, L19I, E34Q, N37NS, R57K, L63M, I64IM, I66F, A71V, G73D, Q92K, C95L  
>1049-30304| codons 4-99
TLWQRPIVTVKIGGQIKEALLDTGADDTVFQEMSLPGRWKPKMVMGIGGLMKVKQYDQIM
MEFCGHKVIDTVLVGPTPANVIGRNVMTKIGLTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SS, M184V, T215Y V75M K103N, Y181C, G190A A98G K64KR, K101R, K122E, H208Y, R211RKT, L228H, V245EK  
>1049-30304| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIRKKDSSKWRKLMDFRELNKRTQDFWEVQLGIPHP
GGLRKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRTKIEELRQYLLTWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006