<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1041 1041-30717 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69G_SG, M184V, L210W, T215CY K70A, V75L L100LI, K103N K238T T39A, S48E, S162A, Q174R, R211K, K223KR, L228H K154KQ, K201KE
>1041-30717| codons 38-247
CAELEKEGKIEKIGPENPYNTPVFAIKKKDSGAWRKLLDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWQGSP
AIFQASMTKILEPFRKRNPDIVIYQYVDDLYVGSDLEIGQHRTEIEELRQHLWKWGFYTP
DKKHQREPPFHWMGYELHPDTWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V V11I, L24I L10I, I15V, L19P, K20V, A22V, K55KR, I62IV, L63P, A71V, I72V, T74S, T91S  
>1041-30717| codons 4-99
TLWQRPIITIKVGGQPVEVLIDTGADDTVLEEMNLPGRWKPKLIGGIGGFVRVRQYDQVP
IEICGHKVVGSVLVGPTPANVIGRNLLSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006