<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS97252 JS97252 Luxembourg 1997 HIV1 B Plasma Unknown

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I3X, M36L, N37X, R41K, R57K, L63P, A71T, V77I, I93L  
>JS97252| codons 1-99
PQXTLWQRPLVTIKIGGQLKEALLDTGADDTVLEELXLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Servais, J Variant human immunodeficiency virus type 1 proteases and response to combination therapy including a protease inhibitor. AAC, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003