<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1038 1038-30609 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210W, T215Y   L100I, K103N   K43Q, V60I, V118I, K122P, I142M, T200A, E204Q, Q207D, R211K A98E
>1038-30609| codons 38-247
CTELEQEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
EGIKKNKSVTVLDVGDAYFSIPLDPDFRKYTAFTIPSINNETPGMRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEQLRDHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82VA, I84IV   L19Q, K20R, E21*, E35D, R57K, I62IV, L63P, A71T, I72V, V77I  
>1038-30609| codons 4-99
TLWQRPLVTIKIGGQQR*ALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFVKVKQYDQVP
IEICGHKTVGTVLIGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006