<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1034 1034-30417 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54V, V82A, L90M L33F, F53L, G73S, L89V L19LI, N37D, R41K, L63P, A71V  
>1034-30417| codons 4-99
TLWQRPLVTIKIGGQIKEALLDTGADDTIFEEMDLPGKWKPKIVGGIGGLVKVRQYDQIP
IEICGHKVISTVLVGPTPANIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69TADN, M184V, L210W, T215Y       T39N, K43E, E44A, K49R, V118I, K122E, D123N, I135IT, S162C, E169D, Q197QE, T200A, K223Q, L228R, V245K  
>1034-30417| codons 38-247
CNELEEAGKISRIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKQNPDIVIYQYVDDLYVGSDLEIGEHRAKIEELRQHLWRWGFYTP
DKKHQQEPPFRWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006