<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1808 1808-30730 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48Q, I54A, V82F, L90M F53L L10I, R41K, D60E, I62V, L63P, I64V, A71V, T74TS, V77I, I93L  
>1808-30730| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIQGIGGLAKVRQYEQVP
VEICGHKVIGSVLIGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M, M184V, T215F F116Y, K219Q Y181C, G190A   V60I, T69N, K101Q, V111I, K122E, I135V, M164L, I167V, I178M, G196E, H208Y, R211A  
>1808-30730| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDIGDAYYSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSP
AIFQSSLTKVLEPFRKQNPDMVICQYVDDLYVASDLEIEQHRTKIEELRQYLLAWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006