<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1708 1708-30513 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V, T215F K219Q L100I, Y181I V179D K101KQ, D123E, Q174R, D177E, I178L, I195L, T200A, R211A, D218E, L228H  
>1708-30513| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGIQKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPELDIIQYVDDLYVGSDLELGQHRAKIEELRQHLLAWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, V82A, L90M L10FV, L33F, K43T, G73S I13V, I15V, K20T, E35N, M36I, N37D, K55R, D60E, I62V, L63E, A71V, V77I  
>1708-30513| codons 4-99
TLWQRPVVTVKVGGQLTEALLDTGADDTVFENIDLPGRWTPKLIGGIGGFMRVRQYEQVE
IEICGHKVISTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006