<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1707 1707-30508 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V L24I, L33F, K43T, G73GC L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71V, T91S  
>1707-30508| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVFEDIDLPGRWTPKMIGGIGGFVKVRQYDQVP
IEICGHKVICTVLVGPTPANVIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F V75M, K219Q K101P, K103RST   T39A, K49R, V60I, D123E, S162D, K166R, G196E, L210F, V245E  
>1707-30508| codons 38-247
CAELEKEGKISRIGPENPYNTPIFAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLPKTKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLFRWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006