<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1705 1705-30409 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M L10F, L33F, G73S, L89V I13V, I15V, L19I, K20V, E35N, M36I, N37T, R41K, I62V, L63P, I66F, A71V, P79A  
>1705-30409| codons 4-99
TLWQRPFVTVKVGGQIVEALLDTGADDTVFENITLPGKWKPKIIGGIGGFMKVRQYDQVP
IEFCGHKVISTVLVGATPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y V75M     T39A, K43E, E44A, R83K, V118I, K122E, I135V, T200A, E203D, H208Y, R211K, L228R  
>1705-30409| codons 38-247
CAELEEAGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNKKTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIDELRQYLWKWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006