<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1704 1704-30407 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A L24I, L33F, Q58E L10I, M36L, R41K, I62V, L63P, T91A  
>1704-30407| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVFEELNLPGKWKPKLIVGIGGFVKVREYDQVP
IEICGHKAIGTVLVGPTPANIIGRNLLAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, T215Y       K43Q, V60I, V118VI, K122E, I178L, G196E, E203K, Q207E, H208Y, L210F, V245E  
>1704-30407| codons 38-247
CTELEQEGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVIYQYVDDLYVGSDLEIEQHRTKIKELREYLFRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006