<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1025 1025-30321 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82S K43T L10I, I15V, G16A, K20T, L38LF, R41K, L63P, I64V, A71V, T74S, V77I, I85V, I93L  
>1025-30321| codons 4-99
TLWQRPIVTIKVAGQLTEALLDTGADDTVLEEMNFPGKWTPKMIVGIGGFSKVRQYDQIP
VEICGHKVIGSVLIGPTPSNIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, V75T, T215Y A62V, K219NS K103N, M230ML   K43E, E44D, K64KR, K82KR, W88C, K104KR, V111I, V118I, K122E, S162A, N175Y, G196GE, T200EIKV, I202IV, E203ED, R211RK, F214FL, D218E L210ST
>1025-30321| codons 38-247
CTELEEDGKISKIGPENPYNTPVFVIRKKNSTKWRKVTDFRELNRRTQDFCEVQLGIPHP
AGLKKNRSVTVLDIGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQYPDIVIYQYMDDLYVGSDLEIEQHRVKVDELRQHLTKWGLYTP
ESKHQKEPPFLWLGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006