<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2242 2242-30707 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, L19LV, N37T, D60E, I62V, L63P, I64V, A71V, I93L T80I
>2242-30707| codons 4-99
TLWQRPIVTIKIGGQVKEALLDTGADDTVLEEMTLPGRWKPKLIGGIGGFVKVRQYEQVP
VEICGHKVIGTVLVGPIPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R K103S, G190A   T39A, E44D, K49R, V60I, V90I, V118VI, K122E, D123E, S162D, E169D, Q207E  
>2242-30707| codons 38-247
CAELEKDGKISRIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKSKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILDPFRKQNPDIVIYQYMDDLYVASDLEIGQHRTKIEELREHLWRWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006