<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1903 1903-30612 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q     K122E, D123N, T139R, S162C, E169D, Q174K, I178L, V179I, D192H, T200I, R211K, F214L, K223R  
>1903-30612| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNERPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKKNPDLIIYQYMDDLYVGSHLEIGQHRIKIEELRQHLLKWGLFTP
DQKHQREPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M Q58E L10V, K14R, L19I, L63P, A71V, I93L  
>1903-30612| codons 4-99
TLWQRPVVTIRIGGQIKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVREYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006