<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1898 1898-30512 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F V75M, K219Q K103N, Y181C   T39A, V60I, T69TS, K122E, D123S, I142V, K166R, D177E, G196E, Q207E, D218E  
>1898-30512| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSSRWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEIVICQYMDDLYVGSDLEIEQHRTKIEELREHLLRWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A, I84V L89LV L10I, I13V, I15V, K20M, L63P, A71T, I72EV, V77VI  
>1898-30512| codons 4-99
TLWQRPIVTVKVGGQLMEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGFVKVRQYDQIP
IEICGHKTVGTVLIGPTPANVIGRNVLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006