<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1729 1729-30617 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, L210W T215E, K219Q K103N, Y181C V108VI T39A, V60I, I135T, I142V, S162A, G196E, E203K, R211K, D218E, L228H, Q242QH, V245Q  
>1729-30617| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIEQHRTKIKELRQHLWKWGFETP
EQKHQKEPPFHWMGYELHPDKWTVHPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I50V, I54L K43KT I13V, K20KR, E35D, M36I, N37T, L63P, I64V, A71AV, P79PA  
>1729-30617| codons 4-99
TLWQRPLVTVKIGGQLREALLDTGADDTILEDITLPGRWTPKIVGGVGGFLKVRQYDQIP
VEICGHKVIGTVLVGATPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006