<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1667 1667-30319 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_EA, M184V, L210W, T215Y D67G Y181C, G190A A98G, V179E T39A, K43Q, W88C, S105T, D177E, R211T, L228H, V245E  
>1667-30319| codons 38-247
CAELEQEGKISKIGPENPYNTPVFAIKKKGSTKWRKLVDFRELNKRTQDFCEVQLGIPHP
GGLKKKKTVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIEICQYVDDLYVASDLEIGQHRTKIEELRQHLWTWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M F53L, Q58E, G73S L10I, G16A, I62V, L63P, A71V  
>1667-30319| codons 4-99
TLWQRPIVTIKIAGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLVKVREYDQVP
IEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006