<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1672 1672-30327 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, Q151M K219N L100I, K103N   S68G, A98S, K122P, A158S, S162A, I178M, E203D, F214L, L228R T69V, D113E
>1672-30327| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDGVKWRKVVDFRELNKRTQDFWEVQLGIPHP
SGIKKNKSVTVLDVGEAFFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
SIFQASMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRTKIDELRQHLLRWGLTTP
DNKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M   L10I, K43I, R57K, L63P, A71V, I93L  
>1672-30327| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWIPKMIVGIGGFVKVKQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006