<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1673 1673-30327 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F, L33F, G73T K14R, E34Q, N37D, R57K, L63P, A71V, I93L  
>1673-30327| codons 4-99
TLWQRPFVTIRIGGQLKEALLDTGADDTVFQEMDLPGRWKPKMIGGIGGFVKVKQYDQIP
IEICGHKVITTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y D67G, V75M, K219R K103H, Y181C, G190A V108I T39A, K43Q, E44D, A98S, K101Q, V118I, K122E, D123E, D177E, G196K, Q207E, R211K, H221Y, L228H  
>1673-30327| codons 38-247
CAELEQDGKISKIGPENPYNTPVFAIKKKGSDKWRKLMDFRELNKRTQDFWEVQLGIPHP
SGLQKHKSVTILDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYVDDLYVASDLEIKQHRTKIEELREHLWKWGFYTP
DRKYQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006