<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1019 1019-30317 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y V75VA, K219N K103N, G190A   T39A, E44D, V106I, V118I, K122E, T200A, E203D, H208Y, D218E, V245L  
>1019-30317| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKIADFRELNKRTQDFWEVQLGIPHP
AGLKKNKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIGQHRAKIDELRQYLWRWGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPILLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82F, L90LM L33F, Q58E L10V, I13V, E35D, M36I, R57K, I62V, L63PS, L89M  
>1019-30317| codons 4-99
TLWQRPVVTVKIGGQLKEALLDTGADDTVFEDINLPGRWKPKIIGGIGGFIKVKEYDQVS
IEICGHKAIGTVLVGPTPFNIIGRNMMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006